If you have been reading about hGH fragment and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2025-12-20. Numbers and descriptions here follow the published literature rather than marketing material.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
Research on AOD-9604 also examines how the peptide is measured in biological samples. Analytical methods may include liquid chromatography coupled with mass spectrometry, immunoassays, or both. Detection can be challenging because the peptide is small and may be present at low concentrations. Published methods vary in sensitivity and specificity, so comparative interpretation requires attention to validation details. The presence of related hGH fragments can complicate identification in some matrices.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Not approved as a medicine | Major agencies have not authorized it for therapeutic use. |
| Anti-doping status | Prohibited in sport | Listed among peptide hormones and related substances. |
| Primary research area | Metabolic and body-composition effects | Studies often examine fat mass or lipid markers. |
| Human evidence | Limited and mixed | Public data do not establish clinical efficacy. |
| Analytical detection | LC-MS and immunoassays | Methods vary in sensitivity and validation. |
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
Symptoms of the disease only appear at an advanced stage, when more than two-thirds of the original kidney function has already been lost. This is due to the body's own compensatory mechanisms and the kidney's reserve capacity, which can compensate for the reduced kidney function for a long time and maintain the excretion of urine-requiring substances. With the loss of functioning nephrons—the functional structural unit of the kidney—the filtering capacity of the renal corpuscles (glomerular filtration rate) decreases and with it the excretory capacity for urinary substances. Acute damage to the tubules can regenerate again if the basement membrane is preserved. However, if a section of the nephron is irreversibly damaged, the entire nephron dies. The increased urea levels in the blood (uremia) lead to nausea and vomiting for various reasons. Firstly, they directly irritate chemoreceptors in the chemoreceptor trigger zone in the brain. Secondly, they increase gastrinsecretion and thus lead to an increase in gastric acid production and thus to hyperacidity of the stomach. Finally, they cause vascular inflammation (uraemic vasculitis), which leads to further damage to the digestive tract. As a result of the accumulation of phosphate in the blood (hyperphosphatemia) and the reduced formation of calcitriol in the remaining main parts, there is a drop in the calcium blood level (hypocalcemia) and increased parathyroid hormone is released from the parathyroid gland. Chronic kidney disease leads to hyperparathyroidism in 84% of cases (secondary renal hyperparathyroidism).
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
==== Enolisation ==== Enolisation of RuBP is the conversion of the keto tautomer of RuBP to an enediol(ate). Enolisation is initiated by deprotonation at C3. The enzyme base in this step has been debated, but the steric constraints observed in crystal structures have made Lys210 the most likely candidate. Specifically, the carbamate oxygen on Lys210 that is not coordinated with the Mg ion deprotonates the C3 carbon of RuBP to form a 2,3-enediolate.
Sources: en.wikipedia.org
=== Other pharmaceutical action === Salvinorin A is capable of inhibiting excess intestinal motility (e.g. diarrhea), through a combination of κ-opioid and cannabinoid (mainly CB1 receptor) receptors in inflamed but not normal gut in vivo. The mechanism of action for Salvinorin A on ileal tissue has been described as 'prejunctional', as it was able to modify electrically induced contractions, but not those of exogenous acetylcholine. Results from a study at the University of Iowa indicate that it may have potential as an analgesic and as a therapeutic tool for treating drug addictions. A pharmacologically important aspect of the contraction-reducing (antispasmodic) properties of ingested Salvinorin A on gut tissue is that it is only pharmacologically active on inflamed and not normal tissue, thus reducing possible side-effects.
At clinically studied doses in humans (up to 600 mg/day), which are much lower on a mg/kg basis than those used in the preceding animal studies, bicalutamide has only shown increases in testosterone levels and no testosterone suppression. There is some indication that the related NSAA nilutamide may also have SARM-like properties in certain tissues, as suggested by stimulation of erythropoiesis in men with prostate cancer. Additionally, hydroxyflutamide, the active metabolite of the related NSAA flutamide, has shown SARM-like activity in an androgen-responsive osteoblast cell line. Similarly, along with CPA, flutamide and hydroxyflutamide, though not bicalutamide, have been reported to act as SARMs or AR partial agonists in prostate cancer cells. Novel SARMs like enobosarm, with antiandrogenic effects in the prostate gland like bicalutamide but potent anabolic effects in muscle and bone, have also been developed. Bicalutamide has also been described as a functional "SARM" due to peripheral selectivity and inability to cross into the central nervous system and block ARs in this part of the body, resulting in antiandrogenic action in the periphery and lack of effects in the brain. However, while peripheral selectivity was initially observed in animal studies, bicalutamide did not end up showing peripheral selectivity in humans.
Umami ( from Japanese: うま味, pronounced [ɯmami]), or savoriness, is one of the five basic tastes. It is characteristic of broths and cooked meats. People taste umami through taste receptors that typically respond to glutamates and nucleotides, which are widely present in meat broths and fermented products. Glutamates are commonly added to some foods in the form of monosodium glutamate (MSG), and nucleotides are commonly added in the form of disodium guanylate, inosine monophosphate (IMP) or guanosine monophosphate (GMP). Since umami has its own receptors rather than arising out of a combination of the traditionally recognized taste receptors, scientists now consider umami to be a distinct taste. Food, beverages, or condiments that have a strong umami flavor include meats, shellfish, fish (including fish sauce and preserved fish such as Maldives fish, katsuobushi, sardines, and anchovies), dashi, tomatoes, mushrooms, hydrolyzed vegetable protein, meat extract (Bouillon cubes), yeast extract (beer, Marmite, Vegemite), kimchi, cheeses (Parmesan, Asiago cheese, or blue cheese), as well as sauces such as A1 sauce, Worcestershire sauce, and soy sauce. In 1908, Kikunae Ikeda of the University of Tokyo scientifically identified umami as a distinct taste attributed to glutamic acid. As a result, in 1909, Ikeda and Saburōsuke Suzuki founded Ajinomoto Co., Inc.
=== eHealth and mobile Health (mHealth) interventions === A new emerging area of support for disease management is through digital technology using eHealth and mobile health (mHealth) interventions. These interventions have to potential to support the development of self-management skills, or assist the healthcare team to monitor symptoms. For JIA, current studies have focused on the health issues pain, health related quality of life, physical activity and disease management. Children and adolescents have used these interventions through a range of devices including computers, laptops, personal digital assistants, multimedia-players, and wearable accelerometers synchronised to smart phone. This allows access to these interventions from home. Early usability studies have been gaining positive feedback by children and adolescents. They are familiar with this type of technology and report liking these interventions. However further research is still needed to understand their full potential in supporting children and adolescents living with complex needs.
Sources: en.wikipedia.org
Spanish descendants in the Masonic exile community with lighter skin tones successfully integrated into Miami, but more trouble was faced by those Afrocuban black and mixed-race members living in the Deep South during the era of Racial segregation in the United States. Where Freemasonry in Cuba had allowed black members since 1868, some of the Lodges in the United States did not allow nonwhite members. After escaping to Florida, Tarajano-Gonzalez issued a declaration that any activities of the Grand Lodge of Cuba would be considered "irregular" and "unlawful" according to their own Masonic tradition, and established the Grand Lodge of Cuba in Exile (Spanish: Gran Logia de Cuba En el Exterior), within the territorial jurisdiction of the Grand Lodge of Florida. They claimed that it was not possible for Freemasonry to exist in a country under a Communist government. They further claimed that the majority of the officers of the Grand Lodge of Cuba had become exiled in the United States. On March 6, 1961, the Grand Lodge in Exile was recognized and granted permission by Edwin Larson, Grand Master of Masons in Florida. On March 15, 1962, the Grand Lodge of Florida proclaimed that they did not recognize any authority of the Freemasons in Cuba, unless those acts were approved by the Grand Master of Masons in Cuba in Exile. In 1963, Grand Master John T. Rose, Jr. of the Grand Lodge of Florida issued an edict which stated their recognition that Grand Master Tarajano-Gonzalez was the only recognized Grand Master of Masons in Cuba.
By seven years of age, all specimens show a three-layered vocal fold structure, based on cellular population densities. At this point, the superficial layer was still hypocellular, the middle layer was the hypercellular one, with also a greater content of elastin and collagen fibers, and the deeper layer was less cellularly populated. Again, the distinction seen between the layers at this stage is not comparable to that seen in the adult tissue. The maturation of the vocal cords did not appear before 13 years of age, where the layers could be defined by their differential fiber composition rather than by their differential cellular population. The pattern now shows a hypocellular superficial layer, followed by a middle layer composed predominantly of elastin fiber, and a deeper layer composed predominantly of collagen fibers. This pattern can be seen in older specimens up to 17 years of age, and above. While this study offers a nice way to see the evolution from immature to mature vocal cords, it still does not explain what is the mechanism behind it.
Lance Henriksen at IMDb Lance Henriksen at the TCM Movie Database (archived) Lance Henriksen at the Internet Broadway Database Films in Review interview Archived September 9, 2018, at the Wayback Machine
Calcium alginate is used in different types of medical products, including skin wound dressings, in the form of hydrogels, to promote healing, since alginate can increase the fluid uptake capacity of dressings, reducing the amount of times the dressing needs to be changed.
== 1971–88 == South Africa was the indirect cause of the 1976 Olympic boycott. A New Zealand rugby union tour of South Africa prompted African countries to demand that the New Zealand Olympic team be excluded from the games. The IOC demurred on the grounds that rugby union was not an Olympic sport and the New Zealand Rugby Union was not affiliated to the New Zealand Olympic Committee. Of 28 African invitees, 26 boycotted the Games, joined by Iraq and Guyana. South Africa continued to compete at the (Summer) Paralympics until excluded by the Dutch government from the 1980 Games. The country had a racially desegregated parasport team from 1975. South Africa was expelled from the International Paralympic Committee in 1985. The IOC adopted a declaration against "apartheid in sport" on 21 June 1988, for the total isolation of apartheid sport.
Sources: en.wikipedia.org
No. It is not approved as a therapeutic drug by major regulators. It is sold for research purposes in many settings, which is not the same as clinical approval.
It is classified among peptide hormones and related substances that are prohibited in sport. The ban reflects anti-doping rules rather than a judgment that the peptide is effective for performance enhancement.
Human studies are limited and have not produced consistent evidence of meaningful clinical benefit. Some early trials examined metabolic endpoints, but larger confirmatory trials are generally lacking.
No. Major drug regulators have not approved AOD-9604 for weight loss or any other therapeutic indication. It remains an investigational compound studied in research settings.