If you have been reading about anti-doping and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-10-21. Where a claim depends on a specific study, the study is described rather than over-claimed.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Fragment analog of human growth hormone |
| Sequence basis | hGH 176–191 region | Modified C-terminal fragment |
| Common synonyms | AOD-9604; AOD9604; hGH fragment | Research and trade names vary |
| Regulatory status | Not approved as a drug | Prohibited in competitive sport |
| Research code | AOD9604 | Used in scientific and patent literature |
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
1 by the Minister, after consultation with such bodies representative of those interests as he may think fit, to represent the interests of persons using bicycles and tricycles, not being motor vehicles, within the London Traffic Area. † An A Licence entitled the holder to drive a motorcycle; a B Licence a motor car; and a C licence a heavy goods vehicle. The Committee and Traffic Area were abolished in 1965 by the London Government Act 1963.
=== Venezuela === Colombia and neighbouring Venezuela have met regularly in the South American Championship, the Copa América and World Cup qualification. Colombia has historically held the superior head-to-head record, but the fixture has gained importance as Venezuela's national team became more competitive from the late 1990s. Venezuela's 1–0 victory in Barranquilla during 2006 World Cup qualification was regarded as a landmark result for the Venezuelan side. In 2026 World Cup qualification, Colombia won 1–0 in Barranquilla in September 2023 and 6–3 in Maturín in September 2025; the latter result eliminated Venezuela from contention for the CONMEBOL inter-confederation play-off place.
A loss of immune tolerance is indicated by the presence of AMAs and autoreactive CD4+ and CD8+ T cells targeting cholangiocytes that line the bile ducts. Cholangiocytes are normally responsible for 40% of bile flow, mostly through secretion of bicarbonate into bile via anion exchanger 2 (AE2) on their apical membrane. The resulting bicarbonate "umbrella" that forms over cholangiocytes provides protection from toxic bile salts. However, in PBC there is repression of AE2 activity due to upregulation of miR-506. This results in decreased biliary bicarbonate secretion and consequently, cholestasis and injury to cholangiocytes by bile salts. Injury may induce cholangiocytes to undergo apoptosis, and during this process, the unique way in which cholangiocytes handle the degradation of PDC-E2 (the E2 subunit of mitochondrial pyruvate dehydrogenase complex) may be a trigger for PSC. Specifically, PDC-E2 in apoptotic cholangiocytes undergo a covalent modification that may render them recognizable to antibodies and thereby trigger a break in self-tolerance. The problem is compounded by cholangiocytes' peculiarly abundant expression of HLA-II and HLA-I, as well as adhesion and chemoattractant molecules, which recruit aid in recruitment of mononuclear immune cells. Both genetic and environmental factors probably contribute to PBC pathogenesis. Genetic predisposition is suggested by high concordance between identical twins, higher incidence among relatives, and a strong association of disease with certain HLA variants.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
== Xenology == Homologs resulting from horizontal gene transfer between two organisms are termed xenologs. Xenologs can have different functions if the new environment is vastly different for the horizontally moving gene. In general, though, xenologs typically have similar function in both organisms. The term was coined by Walter Fitch.
Sources: en.wikipedia.org
== Research == Diazoxide was under development by Lakatos-Topol and Proanagen as a topical solution for the treatment of androgenic alopecia (pattern hair loss) and alopecia areata in the 1980s but was ultimately never marketed. It was intended as a competitor and alternative to minoxidil (Rogaine) for such purposes. The drug applied topically was found to promote scalp hair growth in balding stump-tailed macaques. Under the name Vykat XR, diazoxide choline is an approved therapy for Prader-Willi syndrome and is under investigation for monogenic obesity caused by mutations in the SH2B1, PCSK1, or SIM1 genes.
Ritanserin, also known by its developmental code name R-55667, is a serotonin receptor antagonist which was under development for the treatment of anxiety disorders and major depressive disorder but was never marketed. It was also investigated for treatment of insomnia, especially to enhance sleep quality by significantly increasing slow wave sleep by virtue of potent and concomitant serotonin 5-HT2A and 5-HT2C receptor antagonism. The drug is taken orally.
Post-crash survivability is the chance that drivers and passengers survive a crash after it occurs. Technology such as Advanced Automatic Collision Notification can automatically place calls to emergency services and send information about a vehicle collision. Cars are much more dangerous to pedestrians than they are to drivers and passengers. Two-thirds of 1.3 million yearly auto related deaths are pedestrians. Since at least the early 1970s, attention has also been given to vehicle design regarding the safety of pedestrians in car-pedestrian collisions. Proposals in Europe would require cars sold there to have a minimum/maximum hood (bonnet) height. From 2006, the use of "bull bars", a fashion on 4x4s and SUVs, became illegal in the European Union, after having been banned on all new cars in 2002. Recent research has explored the use of multimodal sensor fusion to improve pedestrian detection in challenging conditions, including low-light environments and unusual pedestrian postures such as prone or fallen individuals.
Abortive initiation, also known as abortive transcription, is an early process of genetic transcription in which RNA polymerase binds to a DNA promoter and enters into cycles of synthesis of short mRNA transcripts which are released before the transcription complex leaves the promoter. This process occurs in both eukaryotes and prokaryotes. Abortive initiation is typically studied in the T3 and T7 RNA polymerases in bacteriophages and in E. coli. Abortive initiation occurs prior to promoter clearance. RNA polymerase binds to promoter DNA to form an RNA polymerase-promoter closed complex RNA polymerase then unwinds one turn of DNA surrounding the transcription start site to yield an RNA polymerase-promoter open complex RNA polymerase enters into abortive cycles of synthesis and releases short RNA products (contains less than 10 nucleotides) RNA polymerase escapes the promoter and enters into the elongation step of transcription
2-AG was discovered by Raphael Mechoulam and his student Shimon Ben-Shabat. 2-AG was a known chemical compound but its occurrence in mammals and its affinity for the cannabinoid receptors were first described in 1994–1995. A research group at Teikyo University reported the affinity of 2-AG for the cannabinoid receptors in 1994–1995, but the isolation of 2-AG in the canine gut was first reported in 1995 by the research group of Raphael Mechoulam at the Hebrew University of Jerusalem, which additionally characterized its pharmacological properties in vivo. 2-Arachidonoylglycerol, next with Anandamide, was the second endocannabinoid discovered. The cannabinoid established the existence of a cannabinoid neuromodulatory system in the nervous system.
Sources: en.wikipedia.org
Amylopectin has seen a rise of use in biomedical applications due to its physiological factors, ease of availability, and low cost. Specifically, amylopectin has very advantageous biochemical properties due to its prevalence as a natural polysaccharide. This causes a high sense of biocompatibility with cells and molecules within the body. Amylopectin is also able to biodegrade to a high degree due to its high sense of crosslinking with 1,6 glycosidic bonds. The bonds easily broken down by the body can reduce molecular weight, expose certain regions, and interact certain bonds with clinical factors. Various physical, chemical, and enzymatic methods of modification have also been researched for amylopectin. These, generally, allow for enhanced and controllable properties which can be selected for the field of research performed. Amylopectin's main role, clinically, is within its integration in starch. Function and structure of amylopectin is based on its integration with amylose and other bounded molecules. Separating these molecules and isolated amylopectin is quite difficult for researchers to perform.
Three of the hydroxylated and glycosylated propeptides twist into a triple helix (except for its ends), forming procollagen. It is packaged into a transfer vesicle destined for the Golgi apparatus. Modification and secretion: In the Golgi apparatus, the procollagen goes through one last post-translational modification, adding oligosaccharides (not monosaccharides as in step 3). Then it is packaged into a secretory vesicle to be secreted from the cell. Tropocollagen formation: Outside the cell, propeptides at both ends of procollagen are removed by specific enzymes – procollagen N-proteinases and C-proteinases – producing tropocollagen. Defects in this step produce collagenopathies such as dermatosparaxis-type Ehlers–Danlos syndrome. For type III collagen this processing is delayed rather than absent: the C-propeptide is cleaved first, leaving a soluble pN-collagen III intermediate, and the N-propeptide is then removed more slowly by the procollagen N-proteinase ADAMTS-2. Collagen fibril formation: Lysyl oxidase, a copper-dependent enzyme, acts on lysines and hydroxylysines, producing aldehyde groups, which eventually form covalent bonds between tropocollagen molecules. This polymer of tropocollagen is called a collagen fibril.
There are 19 known americium isotopes and 11 nuclear isomers, having mass numbers 229 through 247. There are two long-lived alpha-emitters; 243Am has a half-life of 7,350 years and is the most stable isotope, and 241Am has a half-life of 432.6 years. The most stable nuclear isomer is 242m1Am – generally called simply 242mAm – with a long half-life of 141 years. The half-lives of other isotopes and isomers are much shorter with a maximum of 50.8 hours for 240Am. As with most other actinides, the isotopes of americium with odd number of neutrons have relatively high fissionability with thermal neutrons and low critical mass. Americium-241 decays to 237Np emitting alpha particles of several different energies, mostly at 5.486 MeV (85.2%) and 5.443 MeV (12.8%). Because the resulting states are metastable, gamma rays are also emitted at discrete energies between 26.3 and 158.5 keV, by far the strongest is at 59.5 keV. The ground state of Americium-242 is a short-lived isotope with a half-life of 16.02 h. It mostly (82.7%) converts by β-decay to 242Cm, but also by electron capture to 242Pu (17.3%). Nearly all (99.55%) of the metastable 242mAm decays by internal conversion to 242Am and the remaining 0.45% by α-decay to 238Np. Americium-243 transforms by α-emission into 239Np.
Since native human amylin is highly amyloidogenic and potentially toxic, the strategy for designing pramlintide was to substitute residues from rat amylin, which is less amyloidogenic but presumably retains clinical activity. Proline residues are known to be structure-breaking residues, so these were directly grafted into the human sequence. Despite its enhanced stability compared to human amylin, however, pramlintide is still able to organize into amyloid material. Amino acid sequences:
Sources: en.wikipedia.org
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.
It was investigated in clinical trials for obesity, but it did not receive approval for that use in major markets. Results were generally modest or mixed, and it remains an experimental compound.
WADA lists it as a prohibited peptide hormone. Its use can be detected by laboratory methods, and athletes are subject to sanctions if it is found in samples.
Lyophilized AOD9604 is generally kept at -20 °C or colder, desiccated, and protected from light. Reconstituted solutions are usually refrigerated and handled to minimize repeated freeze-thaw cycles. These are general laboratory handling practices, not instructions for human use.